VIMSS92458 has 230 amino acids
Query: DUF421 [M=135]
Accession: PF04239.16
Description: YetF C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-21 62.1 0.0 2.6e-21 61.8 0.0 1.1 1 VIMSS92458
Domain annotation for each sequence (and alignments):
>> VIMSS92458
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.8 0.0 2.6e-21 2.6e-21 2 71 .. 97 166 .. 96 187 .. 0.93
Alignments for each domain:
== domain 1 score: 61.8 bits; conditional E-value: 2.6e-21
DUF421 2 kskklrrlidgkpivliknGkileenlkkarlsiddLlsqLRqqgifsisdVeyailEtnGqlsvlkkke 71
+s+kl++l++gkp+v+i++G++ ++l++++++ ++ ++LR +g+ ++ +V+ ailEtnGq+sv+ ++
VIMSS92458 97 HSEKLEDLLEGKPVVIIEDGELAWSKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFED 166
899**************************************************************98777 PP
Or compare VIMSS92458 to CDD or PaperBLAST