PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS92458 to PF04239 (DUF421)

VIMSS92458 has 230 amino acids

Query:       DUF421  [M=129]
Accession:   PF04239.17
Description: YetF C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      3e-21   61.5   0.0    3.9e-21   61.1   0.0    1.1  1  VIMSS92458  


Domain annotation for each sequence (and alignments):
>> VIMSS92458  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   61.1   0.0   3.9e-21   3.9e-21       2      74 ..      97     168 ..      96     192 .. 0.90

  Alignments for each domain:
  == domain 1  score: 61.1 bits;  conditional E-value: 3.9e-21
      DUF421   2 kskklrrlidgkpivliknGklleenlkkarlsvddLlsqLRqqgifsisdVkfailEtnGqLsvikkkekkp 74 
                 +s+kl++l++gkp+v+i++G+l  ++l++++++  ++ ++LR +g+ ++ +V+ ailEtnGq+sv+  ++ ++
  VIMSS92458  97 HSEKLEDLLEGKPVVIIEDGELAWSKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFED-DK 168
                 899**************************************************************98887.33 PP



Or compare VIMSS92458 to CDD or PaperBLAST