VIMSS93123 has 166 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-58 183.8 9.3 1.4e-58 183.6 9.3 1.0 1 VIMSS93123 Domain annotation for each sequence (and alignments): >> VIMSS93123 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 183.6 9.3 1.4e-58 1.4e-58 2 158 .. 6 162 .. 5 163 .. 0.97 Alignments for each domain: == domain 1 score: 183.6 bits; conditional E-value: 1.4e-58 DUF892 2 leelfideLrDayaaEkqalkalpkmakaaespeLkaaleqHleeTeqqierleqvferlge.easekkcdameglvaegqelleeaiedeevkdaali 99 +e++fi+ L D y+aEkq++kal+k+ ++a s++L+aa+++Hl+eT++qier++qv+ + ++ + +++kc amegl++e++e++e+ +++ev+daali VIMSS93123 6 VEDIFIHLLSDTYSAEKQLTKALSKLSRSAYSDKLTAAFQSHLDETHGQIERIDQVVDSEDGlKLKRIKCAAMEGLIEEANEVIES-TDKNEVRDAALI 103 68*******************************************************98765389********************9.99********** PP DUF892 100 aaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 aaaq+vehyEiasYgtL++lAeqlg ++aa+lL++tl+eEkatd kLt+la + vn++a VIMSS93123 104 AAAQKVEHYEIASYGTLVTLAEQLGYKKAAKLLKETLEEEKATDVKLTDLAFNNVNKKA 162 ********************************************************997 PP
Or compare VIMSS93123 to CDD or PaperBLAST