VIMSS939669 has 352 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-15 41.6 0.1 7.1e-15 40.8 0.1 1.3 1 VIMSS939669
Domain annotation for each sequence (and alignments):
>> VIMSS939669
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 40.8 0.1 7.1e-15 7.1e-15 39 77 .. 6 43 .. 4 52 .. 0.92
Alignments for each domain:
== domain 1 score: 40.8 bits; conditional E-value: 7.1e-15
DUF5981 39 vtrCpksllnGpCgGskngkCevkpekeCawvliyerlk 77
vt+Cpk+llnGpCgG+ n++Cev+ keC wv+i er +
VIMSS939669 6 VTTCPKDLLNGPCGGALNERCEVD-GKECPWVRILERFN 43
789********************9.789*******9975 PP
Or compare VIMSS939669 to CDD or PaperBLAST