PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS93974 to PF08956 (DUF1869)

VIMSS93974 has 60 amino acids

Query:       DUF1869  [M=59]
Accession:   PF08956.14
Description: Domain of unknown function (DUF1869)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.7e-37  111.4   1.8    8.3e-37  111.3   1.8    1.0  1  VIMSS93974  


Domain annotation for each sequence (and alignments):
>> VIMSS93974  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  111.3   1.8   8.3e-37   8.3e-37       2      59 .]       3      60 .]       2      60 .] 0.98

  Alignments for each domain:
  == domain 1  score: 111.3 bits;  conditional E-value: 8.3e-37
     DUF1869  2 eaefllTvTNknNGVSVDkdfsslaeLkdpevaAdvvKdLiNivRgYdsdeetnvCGW 59
                +a++++TvTN++NGVSVD++++++++L +pevaA+v+KdL+N+vR+Yd+++e++vCGW
  VIMSS93974  3 KATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60
                799******************************************************* PP



Or compare VIMSS93974 to CDD or PaperBLAST