VIMSS93974 has 60 amino acids
Query: DUF1869 [M=59] Accession: PF08956.14 Description: Domain of unknown function (DUF1869) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-37 111.4 1.8 8.3e-37 111.3 1.8 1.0 1 VIMSS93974 Domain annotation for each sequence (and alignments): >> VIMSS93974 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.3 1.8 8.3e-37 8.3e-37 2 59 .] 3 60 .] 2 60 .] 0.98 Alignments for each domain: == domain 1 score: 111.3 bits; conditional E-value: 8.3e-37 DUF1869 2 eaefllTvTNknNGVSVDkdfsslaeLkdpevaAdvvKdLiNivRgYdsdeetnvCGW 59 +a++++TvTN++NGVSVD++++++++L +pevaA+v+KdL+N+vR+Yd+++e++vCGW VIMSS93974 3 KATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 799******************************************************* PP
Or compare VIMSS93974 to CDD or PaperBLAST