PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS94015 to PF07351 (DUF1480)

VIMSS94015 has 83 amino acids

Query:       DUF1480  [M=78]
Accession:   PF07351.18
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.5e-47  144.1   0.0    6.3e-47  143.9   0.0    1.0  1  VIMSS94015  


Domain annotation for each sequence (and alignments):
>> VIMSS94015  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.9   0.0   6.3e-47   6.3e-47       3      78 .]       7      82 ..       5      82 .. 0.98

  Alignments for each domain:
  == domain 1  score: 143.9 bits;  conditional E-value: 6.3e-47
     DUF1480  3 ktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
                kt +ri+afeidd +l++e  g+rtl+iPcksdpdlcmqldawd+etsiPa+lng++s+lyr +yd+q+daw+mr+
  VIMSS94015  7 KTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWDAETSIPALLNGEHSVLYRTRYDQQSDAWIMRL 82
                89************************************************************************97 PP



Or compare VIMSS94015 to CDD or PaperBLAST