VIMSS94015 has 83 amino acids
Query: DUF1480 [M=78]
Accession: PF07351.17
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.5e-47 144.1 0.0 6.3e-47 143.9 0.0 1.0 1 VIMSS94015
Domain annotation for each sequence (and alignments):
>> VIMSS94015
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 143.9 0.0 6.3e-47 6.3e-47 3 78 .] 7 82 .. 5 82 .. 0.98
Alignments for each domain:
== domain 1 score: 143.9 bits; conditional E-value: 6.3e-47
DUF1480 3 ktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
kt +ri+afeidd +l++e g+rtl+iPcksdpdlcmqldawd+etsiPa+lng++s+lyr +yd+q+daw+mr+
VIMSS94015 7 KTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWDAETSIPALLNGEHSVLYRTRYDQQSDAWIMRL 82
89************************************************************************97 PP
Or compare VIMSS94015 to CDD or PaperBLAST