PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS940168 to PF01170 (UPF0020)

VIMSS940168 has 209 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.24
Description: RMKL-like, methyltransferase domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      6e-15   41.6   0.1      1e-14   40.8   0.1    1.4  1  VIMSS940168  


Domain annotation for each sequence (and alignments):
>> VIMSS940168  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.8   0.1     1e-14     1e-14      78     138 ..      72     129 ..      44     133 .. 0.92

  Alignments for each domain:
  == domain 1  score: 40.8 bits;  conditional E-value: 1e-14
      UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgsk 138
                  ++y+++ d+++++ areNa++ gv+d+ief++ad+ ++     +vd+++ npP+G  ++++
  VIMSS940168  72 NVYAVERDKEALEIARENARSLGVEDKIEFVNADVSEFS-V--NVDTVIMNPPFGSQVKHA 129
                  489*********************************999.4..5***********998865 PP



Or compare VIMSS940168 to CDD or PaperBLAST