VIMSS940168 has 209 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-15 41.6 0.1 1e-14 40.8 0.1 1.4 1 VIMSS940168
Domain annotation for each sequence (and alignments):
>> VIMSS940168
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 40.8 0.1 1e-14 1e-14 78 138 .. 72 129 .. 44 133 .. 0.92
Alignments for each domain:
== domain 1 score: 40.8 bits; conditional E-value: 1e-14
UPF0020 78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgsk 138
++y+++ d+++++ areNa++ gv+d+ief++ad+ ++ +vd+++ npP+G ++++
VIMSS940168 72 NVYAVERDKEALEIARENARSLGVEDKIEFVNADVSEFS-V--NVDTVIMNPPFGSQVKHA 129
489*********************************999.4..5***********998865 PP
Or compare VIMSS940168 to CDD or PaperBLAST