VIMSS940168 has 209 amino acids
Query: UPF0020 [M=197] Accession: PF01170.24 Description: RMKL-like, methyltransferase domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-15 41.6 0.1 1e-14 40.8 0.1 1.4 1 VIMSS940168 Domain annotation for each sequence (and alignments): >> VIMSS940168 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.8 0.1 1e-14 1e-14 78 138 .. 72 129 .. 44 133 .. 0.92 Alignments for each domain: == domain 1 score: 40.8 bits; conditional E-value: 1e-14 UPF0020 78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgsk 138 ++y+++ d+++++ areNa++ gv+d+ief++ad+ ++ +vd+++ npP+G ++++ VIMSS940168 72 NVYAVERDKEALEIARENARSLGVEDKIEFVNADVSEFS-V--NVDTVIMNPPFGSQVKHA 129 489*********************************999.4..5***********998865 PP
Or compare VIMSS940168 to CDD or PaperBLAST