VIMSS940469 has 471 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-22 66.4 3.3 1e-22 66.4 3.3 3.2 3 VIMSS940469 Domain annotation for each sequence (and alignments): >> VIMSS940469 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.3 0.9 0.022 0.022 44 57 .. 46 59 .. 37 71 .. 0.72 2 ? 1.1 0.0 0.026 0.026 24 37 .. 105 118 .. 83 128 .. 0.79 3 ! 66.4 3.3 1e-22 1e-22 1 68 [] 376 443 .. 376 443 .. 0.97 Alignments for each domain: == domain 1 score: 1.3 bits; conditional E-value: 0.022 DUF402 44 kyiDlyLDvvvypd 57 +y+D+++D+ ++d VIMSS940469 46 TYDDFDVDIYDKKD 59 79*******84333 PP == domain 2 score: 1.1 bits; conditional E-value: 0.026 DUF402 24 rlkgwYvniatppe 37 ++k++Yv++++ + VIMSS940469 105 DEKYVYVDLGSAIG 118 679******99754 PP == domain 3 score: 66.4 bits; conditional E-value: 1e-22 DUF402 1 dlalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 d+a++ l g+w+ v++++d++g+lkg Y ni+tp e++++ +y+Dl++D+v++pdg+ e++D +EL VIMSS940469 376 DYAITELEAGKWWFVHRYYDKNGNLKGEYYNINTPVEIYPDGARYVDLEVDIVKWPDGKKEIIDQEEL 443 6889999*******************************9977*************************8 PP
Or compare VIMSS940469 to CDD or PaperBLAST