VIMSS94083 has 79 amino acids
Query: DUF2492 [M=77]
Accession: PF10678.13
Description: Protein of unknown function (DUF2492)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-41 124.7 0.1 7.8e-41 124.6 0.1 1.0 1 VIMSS94083
Domain annotation for each sequence (and alignments):
>> VIMSS94083
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 124.6 0.1 7.8e-41 7.8e-41 2 77 .] 3 78 .. 2 78 .. 0.99
Alignments for each domain:
== domain 1 score: 124.6 bits; conditional E-value: 7.8e-41
DUF2492 2 siHgHevlelllasgesltrasLkeaieekFGeearFhtCsaedltaeeLiefLlkkgKfiesedglttnaekiCn 77
siHgHevl+++++sge++t+asL++ai+++FGe+arFhtCsae++ta eL++fL++kgKfi+se+g++t+++kiC+
VIMSS94083 3 SIHGHEVLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKGKFIPSEEGFSTDQSKICR 78
8**************************************************************************6 PP
Or compare VIMSS94083 to CDD or PaperBLAST