VIMSS942114 has 306 amino acids
Query: UPF0020 [M=197] Accession: PF01170.24 Description: RMKL-like, methyltransferase domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-28 85.3 0.0 2.6e-27 81.9 0.0 2.0 1 VIMSS942114 Domain annotation for each sequence (and alignments): >> VIMSS942114 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.9 0.0 2.6e-27 2.6e-27 7 176 .. 134 279 .. 128 297 .. 0.87 Alignments for each domain: == domain 1 score: 81.9 bits; conditional E-value: 2.6e-27 UPF0020 7 ngpapLketLAaalvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl 104 + ++L + LA al+rla++++g + lDP+ GsGti++Eaa p +y+ Dld++ + are a + g++ VIMSS942114 134 ALRGSLTPVLAQALLRLADARPGMRVLDPFTGSGTIALEAASTLGPTSP-----------------------VYAGDLDEKRLGLAREAALASGLS-W 207 557899**********************************965554443.......................9**************999888876.6 PP UPF0020 105 iefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltaenkalekal 176 i f ada++L++ evd i++npP G rlg+k+ l +LY+ flr + l ggr +llt l++al VIMSS942114 208 IRFLRADARHLPRFFPEVDRILANPPHGLRLGRKEGLFRLYRDFLRGALALLLPGGRVALLTLRPALLKRAL 279 788888******8888**************************************999999988777666665 PP
Or compare VIMSS942114 to CDD or PaperBLAST