VIMSS948439 has 92 amino acids
Query: DUF493 [M=84]
Accession: PF04359.20
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.6e-25 73.9 0.0 7.3e-25 73.7 0.0 1.0 1 VIMSS948439
Domain annotation for each sequence (and alignments):
>> VIMSS948439
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.7 0.0 7.3e-25 7.3e-25 3 84 .] 11 92 .] 9 92 .] 0.97
Alignments for each domain:
== domain 1 score: 73.7 bits; conditional E-value: 7.3e-25
DUF493 3 lleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
++FP +f++ ++G+ae ++e+++ +++++ e+ +e++++++Ss+gkYvSv++ ++++++eq d+ ++aL++h++vk++L
VIMSS948439 11 GFQFPGTFELSAMGTAERGLETELPRLLAATGVELLEESISWKHSSSGKYVSVRIGFRADTREQFDSAHQALREHPEVKWTL 92
689****************************99***********************************************97 PP
Or compare VIMSS948439 to CDD or PaperBLAST