VIMSS950554 has 280 amino acids
Query: DUF3298 [M=83]
Accession: PF11738.12
Description: Protein of unknown function (DUF3298)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-10 26.6 0.2 9.1e-10 25.7 0.2 1.6 1 VIMSS950554
Domain annotation for each sequence (and alignments):
>> VIMSS950554
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.7 0.2 9.1e-10 9.1e-10 44 81 .. 225 262 .. 173 264 .. 0.77
Alignments for each domain:
== domain 1 score: 25.7 bits; conditional E-value: 9.1e-10
DUF3298 44 ddisaydnFyltddglvfyfnpYeiaPyaaGaieftiP 81
++ + n + + +l f+f+pY+++Py+ G+++ +iP
VIMSS950554 225 AQFVPVLNPAGKISALRFVFPPYQVGPYSDGTQTAEIP 262
55555555555667899********************9 PP
Or compare VIMSS950554 to CDD or PaperBLAST