VIMSS951412 has 189 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-16 46.9 0.0 1.6e-15 43.6 0.0 2.1 2 VIMSS951412 Domain annotation for each sequence (and alignments): >> VIMSS951412 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.6 0.0 1.6e-15 1.6e-15 11 79 .] 37 105 .. 35 105 .. 0.97 2 ? 0.9 0.1 0.034 0.034 1 17 [. 129 145 .. 129 151 .. 0.90 Alignments for each domain: == domain 1 score: 43.6 bits; conditional E-value: 1.6e-15 CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 ll+ +aeR ++ +++a K ++g+pvld++Re++vl+++r++a ++gldp+ ++++f + i++ +++Q+ VIMSS951412 37 LLDKIAERNAIGDAVALSKWDSGKPVLDQAREAAVLQNVRDQAPAHGLDPDDAARFFGAQIEANKSVQY 105 7899*************************************************************9996 PP == domain 2 score: 0.9 bits; conditional E-value: 0.034 CM_2 1 RkeIdeiDrelleLlae 17 R+++d++ ell+ lae VIMSS951412 129 RERLDAVQGELLDALAE 145 899***********998 PP
Or compare VIMSS951412 to CDD or PaperBLAST