VIMSS95448 has 122 amino acids
Query: DUF1090 [M=110]
Accession: PF06476.16
Description: Protein of unknown function (DUF1090)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-40 122.6 18.2 4.6e-40 122.4 18.2 1.0 1 VIMSS95448
Domain annotation for each sequence (and alignments):
>> VIMSS95448
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 122.4 18.2 4.6e-40 4.6e-40 4 110 .] 10 116 .. 6 116 .. 0.93
Alignments for each domain:
== domain 1 score: 122.4 bits; conditional E-value: 4.6e-40
DUF1090 4 lsllaaaaaaalsgCaaKaqaiekqlsaAkahgnkarvagLekalaevkanCtdaslreereqkvaekeeevaereaeLaeaqekgdadkiakrqkkLa 102
++++a a++ C++K+q+i k++s+A++h+n++r++gL+kal+ev+anC+d++lr+++++k+a++++evaer+++Laea++kgdadkiakr++kLa
VIMSS95448 10 SLFALSAGSYATTLCQEKEQNILKEISYAEKHQNQNRIDGLNKALSEVRANCSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRERKLA 108
4455555667899************************************************************************************** PP
DUF1090 103 eaqeeLke 110
eaqeeLk+
VIMSS95448 109 EAQEELKK 116
******96 PP
Or compare VIMSS95448 to CDD or PaperBLAST