VIMSS95584 has 67 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-23 66.9 11.0 7.5e-23 66.7 11.0 1.1 1 VIMSS95584
Domain annotation for each sequence (and alignments):
>> VIMSS95584
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.7 11.0 7.5e-23 7.5e-23 2 56 .] 7 61 .. 6 61 .. 0.97
Alignments for each domain:
== domain 1 score: 66.7 bits; conditional E-value: 7.5e-23
DUF1656 2 idlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
i ++G+ +pp+++ +ll+l++++l+ r+l +g+y +vWhpaLf++al++cl++l
VIMSS95584 7 IVVFGLSFPPIFFELLLSLAIFWLVCRVLVPTGIYDFVWHPALFNTALYCCLFYL 61
889*************************************************986 PP
Or compare VIMSS95584 to CDD or PaperBLAST