VIMSS95619 has 157 amino acids
Query: DUF494 [M=153] Accession: PF04361.17 Description: Protein of unknown function (DUF494) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-63 199.2 4.1 1.8e-63 199.1 4.1 1.0 1 VIMSS95619 Domain annotation for each sequence (and alignments): >> VIMSS95619 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 199.1 4.1 1.8e-63 1.8e-63 1 153 [] 1 157 [] 1 157 [] 0.98 Alignments for each domain: == domain 1 score: 199.1 bits; conditional E-value: 1.8e-63 DUF494 1 mfdvLvYLfenyi..eaealpdedeLeeeLsaaGFeeeeIkkAldwleeLaalqeeeeeaal..aessslRiyteeEqekLdaeargfllfLeqagvld 95 mfdvL+YLfe+yi eae ++d+d+Le++L++aGF++e+I++Al wle+La+ qe +e+++ +++ s+Riyt+eE+e+Lda +rgfllfLeq++vl+ VIMSS95619 1 MFDVLMYLFETYIhtEAELRVDQDKLEQDLTDAGFDREDIYNALLWLEKLADYQEGLAEPMQlaSDPLSMRIYTPEECERLDASCRGFLLFLEQIQVLN 99 9************9999999*************************************99988888999******************************* PP DUF494 96 aetrElvidramaldeeeisledlkwvvlmvlfnqpgeekallileellldeeeellh 153 etrE+vi+r++ald++e++ledlkwv+lmvlfn pg e+a++++eell++ +e++lh VIMSS95619 100 LETREMVIERVLALDTAEFDLEDLKWVILMVLFNIPGCENAYQQMEELLFEVNEGMLH 157 *****************************************************99998 PP
Or compare VIMSS95619 to CDD or PaperBLAST