VIMSS958236 has 77 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-25 74.0 4.3 4.8e-25 73.7 4.3 1.1 1 VIMSS958236
Domain annotation for each sequence (and alignments):
>> VIMSS958236
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.7 4.3 4.8e-25 4.8e-25 1 55 [. 5 59 .. 5 60 .. 0.98
Alignments for each domain:
== domain 1 score: 73.7 bits; conditional E-value: 4.8e-25
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllg 55
E+d+ Gvy++pl+v a++A+++t ll++ll++l+lyr+vWh++Lfd+a++++++g
VIMSS958236 5 EFDIVGVYMHPLVVGAAIAIMITQLLTLLLSKLNLYRFVWHRGLFDTAMLIVVWG 59
9*****************************************************9 PP
Or compare VIMSS958236 to CDD or PaperBLAST