VIMSS98131 has 74 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-25 73.6 0.3 5.6e-25 73.3 0.3 1.1 1 VIMSS98131
Domain annotation for each sequence (and alignments):
>> VIMSS98131
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.3 0.3 5.6e-25 5.6e-25 1 47 [. 13 59 .. 13 60 .. 0.98
Alignments for each domain:
== domain 1 score: 73.3 bits; conditional E-value: 5.6e-25
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
+PC++vC +d ++g+C+GC+Rtl EiaaW r+sd+er+a++a+l+er
VIMSS98131 13 TPCVKVCAVDGASGYCLGCRRTLPEIAAWARLSDDERAAIMAALPER 59
7********************************************98 PP
Or compare VIMSS98131 to CDD or PaperBLAST