PaperBLAST – Find papers about a protein or its homologs

 

Align W6QU90 to PF06073 (DUF934)

W6QU90 has 159 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.1e-28   84.5   0.0    3.1e-28   84.0   0.0    1.2  1  W6QU90    


Domain annotation for each sequence (and alignments):
>> W6QU90  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.0   0.0   3.1e-28   3.1e-28       1      89 [.      50     138 ..      50     147 .. 0.94

  Alignments for each domain:
  == domain 1  score: 84.0 bits;  conditional E-value: 3.1e-28
  DUF934   1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekal 89 
             gv+++ d+d+++l a l+r +++ +efpk +DGRg+++ar LRer++y+g++rA G +l+Dq+++l +cG +++  ++   + ++++a 
  W6QU90  50 GVWVTGDQDPADLLALLNRTRVVVIEFPKSRDGRGFTLARVLRERHRYDGDIRAAGPLLPDQFSMLIQCGYTSVLAEAAIPLVRWKEAA 138
             8*************************************************************************999988887777765 PP



Or compare W6QU90 to CDD or PaperBLAST