PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000005995.1 to PF06006 (DUF905)

WP_000005995.1 has 77 amino acids

Query:       DUF905  [M=70]
Accession:   PF06006.16
Description: Bacterial protein of unknown function (DUF905)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-36  109.9   0.8    2.6e-36  109.8   0.8    1.0  1  WP_000005995.1  


Domain annotation for each sequence (and alignments):
>> WP_000005995.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.8   0.8   2.6e-36   2.6e-36       2      69 ..      10      76 ..       9      77 .] 0.97

  Alignments for each domain:
  == domain 1  score: 109.8 bits;  conditional E-value: 2.6e-36
          DUF905  2 sLpdgtftreqaeavaaqyqnvaieDDqGthlrLvvrkadGemvWraWnfepgaeeglnryiesyGir 69
                     Lpdg+ftr++aeavaaqy+nv ie+D G  +rLvvr+ +G mvWr+Wnfe ga++++n  i+++Gi 
  WP_000005995.1 10 GLPDGPFTRKHAEAVAAQYRNVFIENDHGEQFRLVVRN-NGAMVWRTWNFEDGAGYWMNHVIRDFGII 76
                    69************************************.***************************95 PP



Or compare WP_000005995.1 to CDD or PaperBLAST