WP_000075924.1 has 63 amino acids
Query: DUF2633 [M=43]
Accession: PF11119.12
Description: Protein of unknown function (DUF2633)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.6e-34 101.4 3.5 1.2e-33 101.1 3.5 1.1 1 WP_000075924.1
Domain annotation for each sequence (and alignments):
>> WP_000075924.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 101.1 3.5 1.2e-33 1.2e-33 1 43 [] 7 49 .. 7 49 .. 0.98
Alignments for each domain:
== domain 1 score: 101.1 bits; conditional E-value: 1.2e-33
DUF2633 1 mrrrrrknsrmtRiVLLISFiiLlGRlvYssiGAwehHqdKkq 43
mr+r+r+n+rmtRiVLLISF++++GR+vYssiGAw+hHqdKk+
WP_000075924.1 7 MRKRHRFNTRMTRIVLLISFLFFFGRFVYSSIGAWQHHQDKKE 49
89***************************************97 PP
Or compare WP_000075924.1 to CDD or PaperBLAST