WP_000084657.1 has 232 amino acids
Query: DUF484 [M=225] Accession: PF04340.16 Description: Protein of unknown function, DUF484 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-90 286.8 4.0 7.7e-90 286.6 4.0 1.0 1 WP_000084657.1 Domain annotation for each sequence (and alignments): >> WP_000084657.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 286.6 4.0 7.7e-90 7.7e-90 2 224 .. 5 220 .. 4 221 .. 0.98 Alignments for each domain: == domain 1 score: 286.6 bits; conditional E-value: 7.7e-90 DUF484 2 tkdaldaedVadyLrqhpeFfkqhpelveeLrlphqaantvsLvevqlararerireleeelaalmelAraNerlfarllalqldlldarsledv 96 t+dal+a++Va+yL++hp+Ff++hp+lve+L+lp+q++ +vsL++vqlar+r+ri++leee++alm+lA++N+r+f+++++lq+++l+++sl++v WP_000084657.1 5 TADALTAQVVAEYLYEHPDFFQHHPHLVERLALPTQTG-AVSLAHVQLARQRQRIDSLEEEITALMSLAANNDRTFHEFMDLQEQILKCSSLQAV 98 789**********************************9.******************************************************** PP DUF484 97 lrrleasarelflaaavrlllfhdskvkgesatlevilsskaleelrvdrlggekpilgrlriaekllLfgd.eaeeigSvavvlLssqaplgll 190 l+++ea+arel+l+a+vrll++hd+k+ g l+s++++++++++++g++++lgrlr+a++++L+gd +a+e+gS++v++L++qaplg+l WP_000084657.1 99 LHAIEAKARELNLRAYVRLLQRHDEKY-G--------LASEDWQRFATNHFNGKSAYLGRLRQADRQRLLGDrPAPEMGSYVVLPLQRQAPLGIL 184 ***************************.6........99******************************************************** PP DUF484 191 afgSrDpehfqpgmgTlfLrhlaevlarlle..rws 224 af+S+D+ hfqp+m+TlfLrhla+vla+l+e +w+ WP_000084657.1 185 AFASEDGGHFQPSMDTLFLRHLALVLAHLIEtlPWQ 220 *******************************88887 PP
Or compare WP_000084657.1 to CDD or PaperBLAST