WP_000189916.1 has 103 amino acids
Query: DUF1327 [M=93]
Accession: PF07041.15
Description: Protein of unknown function (DUF1327)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-58 179.9 1.4 5e-58 179.7 1.4 1.0 1 WP_000189916.1
Domain annotation for each sequence (and alignments):
>> WP_000189916.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 179.7 1.4 5e-58 5e-58 1 93 [] 1 93 [. 1 93 [. 0.99
Alignments for each domain:
== domain 1 score: 179.7 bits; conditional E-value: 5e-58
DUF1327 1 mkkdyelvvkGvrnyedkvtvtvaleikerfdlelfdldvaldrveGaalefyeaeakksvkqvflevaeklsekvevileaqyrfklktpal 93
m++dyelvvkGvrn+e+kvtvtval++kerfd+e+fdldva+drveGaalefyea+a++sv+qvflevaeklsekve++l++qy+fk+++pa+
WP_000189916.1 1 MTQDYELVVKGVRNFENKVTVTVALQDKERFDGEIFDLDVAMDRVEGAALEFYEAAARRSVRQVFLEVAEKLSEKVESYLQHQYSFKIENPAN 93
9******************************************************************************************97 PP
Or compare WP_000189916.1 to CDD or PaperBLAST