WP_000206998.1 has 109 amino acids
Query: DUF446 [M=98]
Accession: PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.8e-37 112.6 0.9 4.3e-37 112.4 0.9 1.0 1 WP_000206998.1
Domain annotation for each sequence (and alignments):
>> WP_000206998.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 112.4 0.9 4.3e-37 4.3e-37 2 98 .] 7 103 .. 6 103 .. 0.98
Alignments for each domain:
== domain 1 score: 112.4 bits; conditional E-value: 4.3e-37
DUF446 2 vaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelD 96
v+ +L++lea Lre+++W+++ p++++++st+PF++dt+e+ eWLqw +iprm+ l++++qpLP a+a+ap++e+al++++ +++ +la+l++lD
WP_000206998.1 7 VRLQLQALEALLREHQHWRNDGPQPHQFNSTQPFFMDTMEPLEWLQWGLIPRMHDLLNNNQPLPGAFAVAPYYEMALATDHPQRALILAELEKLD 101
6789******************************************************************************************* PP
DUF446 97 el 98
+l
WP_000206998.1 102 AL 103
86 PP
Or compare WP_000206998.1 to CDD or PaperBLAST