WP_000359624.1 has 146 amino acids
Query: DUF454 [M=115]
Accession: PF04304.17
Description: Protein of unknown function (DUF454)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-41 126.6 7.3 2.9e-41 126.4 7.3 1.1 1 WP_000359624.1
Domain annotation for each sequence (and alignments):
>> WP_000359624.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.4 7.3 2.9e-41 2.9e-41 1 112 [. 33 144 .. 33 146 .] 0.98
Alignments for each domain:
== domain 1 score: 126.4 bits; conditional E-value: 2.9e-41
DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95
r++++ l++l++alG++Gi++P+LPT+ F++lA+f++ar+s++l++w+ +h+++gp+ir+w+e+r ip kaK+i++l+m+l++++++++++++w+
WP_000359624.1 33 RWVFIGLAWLCIALGILGIFIPGLPTVDFMILAVFFAARGSEKLHQWFRNHRYIGPLIREWQEHRRIPKKAKYISTLSMSLAAGLMIWTIPHPWF 127
89********************************************************************************************* PP
DUF454 96 killalvlllvllyllr 112
+ +l++++v+++++
WP_000359624.1 128 VYPAILCMAGVVAWMWL 144
***************96 PP
Or compare WP_000359624.1 to CDD or PaperBLAST