WP_000598518.1 has 1558 amino acids
Query: DUF559 [M=109]
Accession: PF04480.16
Description: Protein of unknown function (DUF559)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-14 38.6 0.1 1.1e-13 37.3 0.1 1.6 1 WP_000598518.1
Domain annotation for each sequence (and alignments):
>> WP_000598518.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 37.3 0.1 1.1e-13 1.1e-13 45 106 .. 533 594 .. 521 597 .. 0.92
Alignments for each domain:
== domain 1 score: 37.3 bits; conditional E-value: 1.1e-13
DUF559 45 ivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlknieevleeilk 106
vDf+ + li+e+DG+qh+++++ D R+++ eslG + +Rf +e+ ++ ++ +++i +
WP_000598518.1 533 QVDFYIPQVGLIIEIDGQQHQNSQHLDEMRDAFTESLGLKTVRFTVQELASENQSFISKINS 594
59**************************************************9999999876 PP
Or compare WP_000598518.1 to CDD or PaperBLAST