WP_000610901.1 has 125 amino acids
Query: DUF525 [M=87]
Accession: PF04379.18
Description: ApaG domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.1e-40 121.3 0.0 9.7e-40 121.1 0.0 1.1 1 WP_000610901.1
Domain annotation for each sequence (and alignments):
>> WP_000610901.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 121.1 0.0 9.7e-40 9.7e-40 2 86 .. 18 102 .. 17 103 .. 0.98
Alignments for each domain:
== domain 1 score: 121.1 bits; conditional E-value: 9.7e-40
DUF525 2 eqsspeeeryvFaYtirienegeesvqLlsrhwiitdangkveevegegVvgeqPvLkpgesfeYtsgvsletpsGsmeGsytmv 86
qssp++eryvFaYt++i+n g+ +vqLl r+w it++ng+++ev+gegVvg qP+++pge+++Ytsg+ +etp G+m+G+y+m
WP_000610901.1 18 AQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMI 102
79*********************************************************************************97 PP
Or compare WP_000610901.1 to CDD or PaperBLAST