PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000617985.1 to PF01817 (CM_2)

WP_000617985.1 has 181 amino acids

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.9e-23   67.2   2.6    3.9e-20   58.4   0.0    2.2  2  WP_000617985.1  


Domain annotation for each sequence (and alignments):
>> WP_000617985.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   58.4   0.0   3.9e-20   3.9e-20      11      79 .]      31      99 ..      29      99 .. 0.98
   2 !    8.4   1.1   0.00016   0.00016       1      20 [.     122     141 ..     122     144 .. 0.93

  Alignments for each domain:
  == domain 1  score: 58.4 bits;  conditional E-value: 3.9e-20
            CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
                    ll  l+eRm l+k++a+yK +++lp+ d  Re+ v+++++e+a+++gldp+ ++ ++r ++++s+a+Q+
  WP_000617985.1 31 LLTALNERMLLMKDVAAYKMKHHLPIEDFTREQNVFAEAEEEAKNNGLDPHSITPFIRSLMDASKAIQY 99
                    899****************************************************************96 PP

  == domain 2  score: 8.4 bits;  conditional E-value: 0.00016
            CM_2   1 RkeIdeiDrelleLlaeRme 20 
                     R++I ++D+++l ++++R+ 
  WP_000617985.1 122 RQRIRQLDNQMLIIISQRLM 141
                     9*****************85 PP



Or compare WP_000617985.1 to CDD or PaperBLAST