WP_000692323.1 has 73 amino acids
Query: DUF987 [M=65]
Accession: PF06174.15
Description: Protein of unknown function (DUF987)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.9e-44 133.8 0.0 8.8e-44 133.7 0.0 1.0 1 WP_000692323.1
Domain annotation for each sequence (and alignments):
>> WP_000692323.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 133.7 0.0 8.8e-44 8.8e-44 1 65 [] 1 65 [. 1 65 [. 0.99
Alignments for each domain:
== domain 1 score: 133.7 bits; conditional E-value: 8.8e-44
DUF987 1 mkiitkkeAveiarqhpasrlfkyctGKYkWhGsasdYtGrdvddipgvLAvyaERRkdaagpyv 65
mkiit++eA++i++qhp srlf++ctGKY+WhGsa++YtGr+v+dipgvLAv+aERRkd++gpyv
WP_000692323.1 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYV 65
9***************************************************************7 PP
Or compare WP_000692323.1 to CDD or PaperBLAST