PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000720060.1 to PF03891 (DUF333)

WP_000720060.1 has 144 amino acids

Query:       DUF333  [M=48]
Accession:   PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.4e-28   82.7   0.2    1.8e-27   81.7   0.2    1.5  1  WP_000720060.1  


Domain annotation for each sequence (and alignments):
>> WP_000720060.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   81.7   0.2   1.8e-27   1.8e-27       2      47 ..      32      76 ..      31      77 .. 0.96

  Alignments for each domain:
  == domain 1  score: 81.7 bits;  conditional E-value: 1.8e-27
          DUF333  2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47
                     +NPAs+yCv+qGGklei+++a+ gq+gyC+Lp+G++veeW+l+r 
  WP_000720060.1 32 SPNPASQYCVEQGGKLEIRNEAN-GQVGYCHLPNGQVVEEWKLFRD 76
                    58*********************.*********************7 PP



Or compare WP_000720060.1 to CDD or PaperBLAST