WP_000720060.1 has 144 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.4e-28 82.7 0.2 1.8e-27 81.7 0.2 1.5 1 WP_000720060.1
Domain annotation for each sequence (and alignments):
>> WP_000720060.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.7 0.2 1.8e-27 1.8e-27 2 47 .. 32 76 .. 31 77 .. 0.96
Alignments for each domain:
== domain 1 score: 81.7 bits; conditional E-value: 1.8e-27
DUF333 2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47
+NPAs+yCv+qGGklei+++a+ gq+gyC+Lp+G++veeW+l+r
WP_000720060.1 32 SPNPASQYCVEQGGKLEIRNEAN-GQVGYCHLPNGQVVEEWKLFRD 76
58*********************.*********************7 PP
Or compare WP_000720060.1 to CDD or PaperBLAST