WP_000750393.1 has 75 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-27 81.5 3.4 1.9e-27 81.3 3.4 1.1 1 WP_000750393.1
Domain annotation for each sequence (and alignments):
>> WP_000750393.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.3 3.4 1.9e-27 1.9e-27 1 47 [. 24 70 .. 24 72 .. 0.98
Alignments for each domain:
== domain 1 score: 81.3 bits; conditional E-value: 1.9e-27
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqI 47
+yv++T+DG+ ivt+gkP++D+dtGm++Y+d++G+++qIn+ dVk++
WP_000750393.1 24 NYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEM 70
7********************************************98 PP
Or compare WP_000750393.1 to CDD or PaperBLAST