WP_000753036.1 has 202 amino acids
Query: YqiJ_OB [M=64]
Accession: PF07290.15
Description: Inner membrane protein YqiJ, OB-fold
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-21 62.4 0.0 2.8e-21 61.7 0.0 1.3 1 WP_000753036.1
Domain annotation for each sequence (and alignments):
>> WP_000753036.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.7 0.0 2.8e-21 2.8e-21 2 63 .. 130 189 .. 129 189 .. 0.92
Alignments for each domain:
== domain 1 score: 61.7 bits; conditional E-value: 2.8e-21
YqiJ_OB 2 lvGrvatitlGtArrgspAeAkvkDehgqtHYvmVEPdeedevfeeGseVllvrkegalfra 63
l+Gr+ati+ G Ar g +A+A+v+De+gq HYv+VEP+ + e s+V+l++ ++ ++ a
WP_000753036.1 130 LLGRLATISSGSARPGFSAQARVRDEFGQLHYVQVEPEYGEL--ELYSQVILIKVHKSHYVA 189
89***********************************99766..67799****999999976 PP
Or compare WP_000753036.1 to CDD or PaperBLAST