WP_000841001.1 has 112 amino acids
Query: DUF413 [M=90]
Accession: PF04219.16
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-42 129.7 0.1 1.9e-42 129.5 0.1 1.0 1 WP_000841001.1
Domain annotation for each sequence (and alignments):
>> WP_000841001.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 129.5 0.1 1.9e-42 1.9e-42 1 88 [. 10 97 .. 10 99 .. 0.98
Alignments for each domain:
== domain 1 score: 129.5 bits; conditional E-value: 1.9e-42
DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgt 88
r++D+k++prGfsr+GdFtikea+lLe++G+a+++L+ g++epvteeek fv+v++ge+++ +e+e+vW+kY+ +i+++krfhtl+g
WP_000841001.1 10 RYFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNELDLGKREPVTEEEKLFVAVCRGEREPVTEAERVWSKYMTRIKRPKRFHTLSGG 97
79***********************************************************************************986 PP
Or compare WP_000841001.1 to CDD or PaperBLAST