WP_000844798.1 has 75 amino acids
Query: DUF2525 [M=60]
Accession: PF10733.13
Description: Protein of unknown function (DUF2525)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.4e-39 118.5 1.5 6.8e-39 118.1 1.5 1.1 1 WP_000844798.1
Domain annotation for each sequence (and alignments):
>> WP_000844798.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.1 1.5 6.8e-39 6.8e-39 1 60 [] 18 75 .] 18 75 .] 0.99
Alignments for each domain:
== domain 1 score: 118.1 bits; conditional E-value: 6.8e-39
DUF2525 1 dVDALLaAineitesevqeaisaddaqrvtvdGreyhtytELAeAfELDIrDFsvsEvNR 60
dVDALLaAinei+esev++ s++d++rv+vdGreyht+ ELAeAfELDI+DFsv+EvNR
WP_000844798.1 18 DVDALLAAINEISESEVHR--SQEDPERVSVDGREYHTWHELAEAFELDIHDFSVTEVNR 75
9******************..**************************************9 PP
Or compare WP_000844798.1 to CDD or PaperBLAST