PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000886005.1 to PF07166 (DUF1398)

WP_000886005.1 has 129 amino acids

Query:       DUF1398  [M=119]
Accession:   PF07166.15
Description: Protein of unknown function (DUF1398)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.5e-29   87.6   0.8    4.2e-29   87.4   0.8    1.0  1  WP_000886005.1  


Domain annotation for each sequence (and alignments):
>> WP_000886005.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.4   0.8   4.2e-29   4.2e-29       9     118 ..      16     125 ..       9     126 .. 0.94

  Alignments for each domain:
  == domain 1  score: 87.4 bits;  conditional E-value: 4.2e-29
         DUF1398   9 sdadfpafiqelkrlgvshYeyfvatgnvkyvtendevvsvkakrellkvaekknaekikaalkkhqsgeitfeqfceelAkaGvfkWivdlnek 103
                      + dfp++ +++k +g+++ +  +++g  +yv +++  +   + ++   va+k+n++ ++  l++hq+g+++fe+fc e+A+aG+ kW +d+++ 
  WP_000886005.1  16 TGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVKSNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAG 110
                     589******************************99999999999999************************************************ PP

         DUF1398 104 trsYydkdnslLlaE 118
                     t++Y d +++ + +E
  WP_000886005.1 111 TCTYIDLQDQAVISE 125
                     **********99887 PP



Or compare WP_000886005.1 to CDD or PaperBLAST