PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000935247.1 to PF06073 (DUF934)

WP_000935247.1 has 161 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.9e-36  108.6   0.1    9.1e-36  108.3   0.1    1.2  1  WP_000935247.1  


Domain annotation for each sequence (and alignments):
>> WP_000935247.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  108.3   0.1   9.1e-36   9.1e-36       3     105 ..      54     155 ..      52     157 .. 0.94

  Alignments for each domain:
  == domain 1  score: 108.3 bits;  conditional E-value: 9.1e-36
          DUF934   3 llasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYq 97 
                      ++ ++++e+++  l++l+ i +ef+ F DGRgyS a lLR r g++gelrA+Gdv++D l++lkr+Gfd+f+++e+kd+++a++ l++f++ Yq
  WP_000935247.1  54 YVTVNDSPEDHTFPLSELDAIFIEFAGFGDGRGYSFAALLR-RQGFQGELRATGDVFKDVLNYLKRSGFDSFVIKEGKDVQEAAAGLQDFTHPYQ 147
                     567789999999*****************************.55*************************************************** PP

          DUF934  98 aavdeeqp 105
                     a+++ +++
  WP_000935247.1 148 ASTAVPKA 155
                     *9987765 PP



Or compare WP_000935247.1 to CDD or PaperBLAST