WP_000991489.1 has 347 amino acids
Query: DUF418 [M=163] Accession: PF04235.16 Description: Protein of unknown function (DUF418) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-35 108.9 12.4 1.3e-35 108.9 12.4 2.7 3 WP_000991489.1 Domain annotation for each sequence (and alignments): >> WP_000991489.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.0 0.23 0.23 65 65 .. 59 59 .. 19 90 .. 0.49 2 ? -1.2 2.7 0.1 0.1 94 120 .. 138 163 .. 58 184 .. 0.58 3 ! 108.9 12.4 1.3e-35 1.3e-35 1 162 [. 189 339 .. 189 340 .. 0.93 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.23 DUF418 65 l 65 WP_000991489.1 59 G 59 2 PP == domain 2 score: -1.2 bits; conditional E-value: 0.1 DUF418 94 ALTnYllqsivctllfygyglglfgsl 120 +L+ ++ i+++++ y y ++l + + WP_000991489.1 138 SLSLHVMG-IIVSIISYDYIFQLKSNI 163 22222222.222333334444443333 PP == domain 3 score: 108.9 bits; conditional E-value: 1.3e-35 DUF418 1 lgrkgllkdgeehkrllrrllliglavglplalllallaelaeesallslllevlsmlgglalalgYvalillllkkekrrrllrplaavGRmAL 95 l++ +l++ +++++l + l+++ +v+++ ++++ ++++ l+++l + +++l++ Y+ +++ llk++ ++++l+pl+a+GRm + WP_000991489.1 189 LMKLDVLTKLKQRPKLHKLLIIMFSIVSITGVTVQM--------LTPSAKLSFILLNILQPFLTITYILILVALLKSTVGSTVLKPLQAYGRMGM 275 6899999*8888888888888888888888888888........99************************************************* PP DUF418 96 TnYllqsivctllfygyglglfgslgrlallllallifllqlllSklwlrrfrqGPlEwlwRkltyg 162 +nYl q+ ++++++ +++l +f+ +++a++ +++l +++q+++S++wl++f++GP+Ew+wR+lty+ WP_000991489.1 276 SNYLGQTFIGMFIL-PITLSVFS--PAIAMVSMCFLTWIFQIAISNVWLKYFNFGPVEWIWRCLTYW 339 **************.99999887..56799************************************9 PP
Or compare WP_000991489.1 to CDD or PaperBLAST