WP_001008488.1 has 161 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-50 157.7 5.3 1.3e-50 157.5 5.3 1.0 1 WP_001008488.1 Domain annotation for each sequence (and alignments): >> WP_001008488.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.5 5.3 1.3e-50 1.3e-50 1 145 [. 7 150 .. 7 151 .. 0.98 Alignments for each domain: == domain 1 score: 157.5 bits; conditional E-value: 1.3e-50 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnlt 95 l+++Y+eia++i+ miP+eWe+v+++a+v++++gev+F+y+k++s++l+y++ ip++ynvse+++ +l+++Ly+l+k+lr+ fk e+ e+Wt+++ WP_001008488.1 7 LSQMYNEIANEISGMIPVEWEQVFTIAYVTDQAGEVIFNYTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFK-EDLEPWTSCE 100 689********************************************************************************7.589******* PP YezG-like 96 lslkksGklkiefnyddllnseldsserkiiwkykklgilpeeekekell 145 ++++++G+lk++f+y d+++ + +s ++++++ykk+g+lpe+e+e+e++ WP_001008488.1 101 FDFTREGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGVLPETEYEMEEI 150 ***********************************************998 PP
Or compare WP_001008488.1 to CDD or PaperBLAST