WP_001053167.1 has 187 amino acids
Query: DUF179 [M=157] Accession: PF02622.19 Description: Uncharacterized ACR, COG1678 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-56 175.9 0.0 3.4e-56 175.7 0.0 1.0 1 WP_001053167.1 Domain annotation for each sequence (and alignments): >> WP_001053167.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 175.7 0.0 3.4e-56 3.4e-56 1 157 [] 12 174 .. 12 174 .. 0.95 Alignments for each domain: == domain 1 score: 175.7 bits; conditional E-value: 3.4e-56 DUF179 1 PsledpnFersVvllcehneegamGlvlNrpl.eltlkelleelleleaepaaee.....pvylGGPveqdrlfvlhsle..lessleisdglyl 87 P+l+dp F+rsVv++cehn++gamG+++N+pl +l+++ +le+ l+++ ep++++ v+lGGP+++dr+f+lh+ + + ss++isd++++ WP_001053167.1 12 PALQDPIFRRSVVYICEHNQDGAMGIIINKPLeNLQIEGILEK-LKITPEPRDSAirldkAVMLGGPLAEDRGFILHTPPsrFASSIRISDNTVI 105 89******************************99*********.7888777776358*********************55679************ PP DUF179 88 tgsldilealaggagpeklrvflGyagWgagQLeeEieenaWlvvpasdeellfetppeelWeealrrlG 157 t+s+d+le+l ++++p++++v+lGya+W++gQLe+E+ +naWl++pa d ++lf+tp +e+W+ea++ +G WP_001053167.1 106 TTSRDVLETLGTQQQPSDVLVALGYASWDKGQLEQELLDNAWLTAPA-DLNILFKTPIAERWREAAKLIG 174 ***********************************************.888***************9998 PP
Or compare WP_001053167.1 to CDD or PaperBLAST