WP_001135904.1 has 75 amino acids
Query: DUF1414 [M=44]
Accession: PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-29 88.0 1.1 2e-29 87.7 1.1 1.2 1 WP_001135904.1
Domain annotation for each sequence (and alignments):
>> WP_001135904.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.7 1.1 2e-29 2e-29 1 44 [] 26 69 .. 26 69 .. 0.99
Alignments for each domain:
== domain 1 score: 87.7 bits; conditional E-value: 2e-29
DUF1414 1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
HkAp+DLsLMvLGN+vTn++n+sV++aqR+aiA++Fa AL+sS+
WP_001135904.1 26 HKAPTDLSLMVLGNMVTNLINTSVAPAQRQAIANSFARALQSSI 69
9******************************************8 PP
Or compare WP_001135904.1 to CDD or PaperBLAST