PaperBLAST – Find papers about a protein or its homologs

 

Align WP_001188905.1 to PF04304 (DUF454)

WP_001188905.1 has 125 amino acids

Query:       DUF454  [M=115]
Accession:   PF04304.17
Description: Protein of unknown function (DUF454)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.3e-46  141.6  17.3      6e-46  141.5  17.3    1.0  1  WP_001188905.1  


Domain annotation for each sequence (and alignments):
>> WP_001188905.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  141.5  17.3     6e-46     6e-46       1     114 [.       3     116 ..       3     117 .. 0.99

  Alignments for each domain:
  == domain 1  score: 141.5 bits;  conditional E-value: 6e-46
          DUF454   1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95 
                     r++l+++G+l+++lG++G+vlP+LPTtpF+LlAa+cfarsspr+++wLl +++fg+y+r w++++a+p+ +K +a+ll++l+++isl++v+++wv
  WP_001188905.1   3 RIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWV 97 
                     799******************************************************************************************** PP

          DUF454  96 killalvlllvllyllrlp 114
                     +i+l+++l+++l+y++r+p
  WP_001188905.1  98 RIMLLVILACLLFYMWRIP 116
                     *****************98 PP



Or compare WP_001188905.1 to CDD or PaperBLAST