WP_001331705.1 has 77 amino acids
Query: DUF3950 [M=30]
Accession: PF13132.10
Description: Domain of unknown function (DUF3950)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-25 72.8 0.8 1.5e-24 71.9 0.8 1.5 1 WP_001331705.1
Domain annotation for each sequence (and alignments):
>> WP_001331705.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.9 0.8 1.5e-24 1.5e-24 1 30 [] 21 50 .. 21 50 .. 1.00
Alignments for each domain:
== domain 1 score: 71.9 bits; conditional E-value: 1.5e-24
DUF3950 1 mleQIeiaLekektsNFSAWVkEACRekLc 30
m+eQI+iaL +++++NFSAWV+EACR++Lc
WP_001331705.1 21 MIEQINIALVQKGSGNFSAWVIEACRRRLC 50
9***************************** PP
Or compare WP_001331705.1 to CDD or PaperBLAST