WP_001961577.1 has 161 amino acids
Query: NTPase_I-T [M=162] Accession: PF01931.22 Description: Protein of unknown function DUF84 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-57 179.0 0.0 3.6e-57 178.9 0.0 1.0 1 WP_001961577.1 Domain annotation for each sequence (and alignments): >> WP_001961577.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.9 0.0 3.6e-57 3.6e-57 9 162 .] 2 153 .. 1 153 [. 0.96 Alignments for each domain: == domain 1 score: 178.9 bits; conditional E-value: 3.6e-57 NTPase_I-T 9 eAveeafeklfke..vevegvsvpsgvseqPlgdeetlkGAinRaknalekae.adygVGiEgGveelegklldvawaavidkegrvsvgrsaaf 100 +Av++af+++f++ +e++gvsv+s+v++qP++deet +GA+nR++na+++++ a+y+VG+E+G+ee ++aw++v + ++ + +rsa + WP_001961577.1 2 NAVRSAFSTVFPDqeWEFIGVSVQSEVADQPMSDEETKQGALNRVRNAKQHHPgAEYYVGLEAGIEE----NKTFAWMIVESD-QQRGESRSACL 91 8***********97888************************************************98....6789***66665.899******** PP NTPase_I-T 101 elPeevveeiregeelgevmdelfgtenikekeGaigllTkglvtRkdlyeqavilAlipfl 162 +lP+ v+e++r+ +elg+vmde+fgtenik+k+GaigllT++++tR+++y+qa+ilAlipf+ WP_001961577.1 92 MLPPLVLERLRQAKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFI 153 ************************************************************97 PP
Or compare WP_001961577.1 to CDD or PaperBLAST