WP_002355538.1 has 177 amino acids
Query: DUF402 [M=68]
Accession: PF04167.18
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-23 67.6 2.9 4.3e-23 67.6 2.9 2.1 2 WP_002355538.1
Domain annotation for each sequence (and alignments):
>> WP_002355538.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.6 2.9 4.3e-23 4.3e-23 2 68 .] 60 124 .. 59 124 .. 0.96
2 ? -0.6 0.1 0.084 0.084 15 32 .. 149 166 .. 139 172 .. 0.72
Alignments for each domain:
== domain 1 score: 67.6 bits; conditional E-value: 4.3e-23
-EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS
DUF402 2 lalwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68
+a+++++++ w+n++++++e +++ +Y+n+a+p ++++++kyiD+dLD++v+pdge ++lD+dE+
WP_002355538.1 60 PAIVYFHKKYWFNIIAMIRE--KGVSYYCNLASPYVLDDEALKYIDYDLDIKVFPDGEKRLLDVDEY 124
789****************9..9***********88877***************************7 PP
== domain 2 score: -0.6 bits; conditional E-value: 0.084
EEEEEETTTEEEEEEEEE CS
DUF402 15 vtkfldedgrfkgwYvni 32
v + ++e+g f Yv+i
WP_002355538.1 149 VDWINNEKGPFSPEYVDI 166
667777777888888887 PP
Or compare WP_002355538.1 to CDD or PaperBLAST