WP_002358053.1 has 101 amino acids
Query: DUF898 [M=336] Accession: PF05987.17 Description: Bacterial protein of unknown function (DUF898) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-20 58.4 10.2 3.6e-14 38.6 4.7 2.0 2 WP_002358053.1 Domain annotation for each sequence (and alignments): >> WP_002358053.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.8 0.2 3.5e-11 3.5e-11 6 64 .. 6 64 .. 2 65 .. 0.96 2 ! 38.6 4.7 3.6e-14 3.6e-14 3 48 .. 53 98 .. 51 100 .. 0.95 Alignments for each domain: == domain 1 score: 28.8 bits; conditional E-value: 3.5e-11 DUF898 6 FtGsggeyfriwivNllLtivTLGiYsaWakvrtrrYfygnTrldgspfeYtatplell 64 F+G+ +y++ i +l t+ TLGi +W + + ++T +dg+++ + +t ++l+ WP_002358053.1 6 FDGDLATYIGTSILATLITVFTLGICAPWGICMMYNWKIKHTVIDGKRLYFDGTAMQLF 64 9********************************************************98 PP == domain 2 score: 38.6 bits; conditional E-value: 3.6e-14 DUF898 3 rvaFtGsggeyfriwivNllLtivTLGiYsaWakvrtrrYfygnTr 48 r+ F+G++ ++f+ wi llLti+TLGiY +W r +++ ++T WP_002358053.1 53 RLYFDGTAMQLFGHWIKWLLLTIITLGIYGFWLNIRLQQWITKHTH 98 788**************************************99996 PP
Or compare WP_002358053.1 to CDD or PaperBLAST