PaperBLAST – Find papers about a protein or its homologs

 

Align WP_002358053.1 to PF05987 (DUF898)

WP_002358053.1 has 101 amino acids

Query:       DUF898  [M=336]
Accession:   PF05987.17
Description: Bacterial protein of unknown function (DUF898)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.4e-20   58.4  10.2    3.6e-14   38.6   4.7    2.0  2  WP_002358053.1  


Domain annotation for each sequence (and alignments):
>> WP_002358053.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.8   0.2   3.5e-11   3.5e-11       6      64 ..       6      64 ..       2      65 .. 0.96
   2 !   38.6   4.7   3.6e-14   3.6e-14       3      48 ..      53      98 ..      51     100 .. 0.95

  Alignments for each domain:
  == domain 1  score: 28.8 bits;  conditional E-value: 3.5e-11
          DUF898  6 FtGsggeyfriwivNllLtivTLGiYsaWakvrtrrYfygnTrldgspfeYtatplell 64
                    F+G+  +y++  i  +l t+ TLGi  +W    +  +  ++T +dg+++ + +t ++l+
  WP_002358053.1  6 FDGDLATYIGTSILATLITVFTLGICAPWGICMMYNWKIKHTVIDGKRLYFDGTAMQLF 64
                    9********************************************************98 PP

  == domain 2  score: 38.6 bits;  conditional E-value: 3.6e-14
          DUF898  3 rvaFtGsggeyfriwivNllLtivTLGiYsaWakvrtrrYfygnTr 48
                    r+ F+G++ ++f+ wi  llLti+TLGiY +W   r +++  ++T 
  WP_002358053.1 53 RLYFDGTAMQLFGHWIKWLLLTIITLGIYGFWLNIRLQQWITKHTH 98
                    788**************************************99996 PP



Or compare WP_002358053.1 to CDD or PaperBLAST