PaperBLAST – Find papers about a protein or its homologs

 

Align WP_002887654.1 to PF07256 (DUF1435)

WP_002887654.1 has 79 amino acids

Query:       DUF1435  [M=75]
Accession:   PF07256.16
Description: Protein of unknown function (DUF1435)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.2e-36  109.7   8.6    3.6e-36  109.6   8.6    1.0  1  WP_002887654.1  


Domain annotation for each sequence (and alignments):
>> WP_002887654.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.6   8.6   3.6e-36   3.6e-36       1      73 [.       1      73 [.       1      75 [. 0.98

  Alignments for each domain:
  == domain 1  score: 109.6 bits;  conditional E-value: 3.6e-36
         DUF1435  1 mlqrtlssgWGvlLPavliallalldlsldqlkvlivlgllltllmLyhkrlRhylLLPsclaligGlvllll 73
                    mlqr l+sgWGv++P++li++l+++++s+d ++vl+++g+l++++m++h++lRh++LLPsc+aligG++l+++
  WP_002887654.1  1 MLQRALGSGWGVMIPGALIVALGYAGVSADVWRVLVAVGMLMSAAMIWHRQLRHFILLPSCVALIGGIMLMIV 73
                    9*********************************************************************997 PP



Or compare WP_002887654.1 to CDD or PaperBLAST