WP_002893037.1 has 82 amino acids
Query: DUF1158 [M=79]
Accession: PF06643.15
Description: Protein of unknown function (DUF1158)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-53 165.3 9.9 2.1e-53 165.2 9.9 1.0 1 WP_002893037.1
Domain annotation for each sequence (and alignments):
>> WP_002893037.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 165.2 9.9 2.1e-53 2.1e-53 1 79 [] 1 79 [. 1 79 [. 1.00
Alignments for each domain:
== domain 1 score: 165.2 bits; conditional E-value: 2.1e-53
DUF1158 1 mkhpletllsaagilllallsclllpapslglalaqklvetfhlmdlnqlytllfclwflllgaveylvirfiwrrwfs 79
mkhpletllsaagilllallsclllpapslgl+laqklvetfh+mdlnqlyt+lfclwfl+lga+eylv+r++wrrwfs
WP_002893037.1 1 MKHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMMDLNQLYTVLFCLWFLALGAIEYLVLRWVWRRWFS 79
9*****************************************************************************8 PP
Or compare WP_002893037.1 to CDD or PaperBLAST