WP_003201298.1 has 103 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-21 62.0 0.1 3.3e-21 61.8 0.1 1.1 1 WP_003201298.1
Domain annotation for each sequence (and alignments):
>> WP_003201298.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.8 0.1 3.3e-21 3.3e-21 1 78 [. 16 92 .. 16 93 .. 0.96
Alignments for each domain:
== domain 1 score: 61.8 bits; conditional E-value: 3.3e-21
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+eId++D+ + Ll +R++++ ++ ++K+ + +v peR +++l+ +r++ae++gl+p+a+ek++ +++++++a +
WP_003201298.1 16 RREIDALDQAVITLLGKRYQYVLAASKFKT-SATSVQAPERLKAMLATRRKWAEAEGLSPDAIEKMYSDLVHHFIAEE 92
99***************************5.666***************************************99987 PP
Or compare WP_003201298.1 to CDD or PaperBLAST