WP_003220110.1 has 405 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-21 61.8 0.0 5.3e-21 61.2 0.0 1.2 1 WP_003220110.1 Domain annotation for each sequence (and alignments): >> WP_003220110.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.2 0.0 5.3e-21 5.3e-21 3 127 .. 252 377 .. 250 394 .. 0.93 Alignments for each domain: == domain 1 score: 61.2 bits; conditional E-value: 5.3e-21 EryCIII-like_C 3 vldqvaelDaEivvalded.arpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 l+ ++D+ +v+++ ++ ++++l+++p+n + +vP +l+ ++ +v hgG st +l f P vv+p +ad+++ +++v ++Gag vl+ WP_003220110.1 252 CLEVCKDFDGKVVLSIGKHiKANELNDIPENFIVRPYVPQLEILKRASLFVTHGGMNSTSEGLYFETPLVVIPMGADQFAVGNQVEKIGAGKVLK 346 5777889*********87637899*******8888************************************************************ PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklae 127 k++l ++++++ev+++p y + a+ + + WP_003220110.1 347 KEQLSEGLLKETIHEVMNNPVYAEKAKDIGQ 377 *************************998866 PP
Or compare WP_003220110.1 to CDD or PaperBLAST