WP_003460364.1 has 159 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-28 84.5 0.0 3.1e-28 84.0 0.0 1.2 1 WP_003460364.1
Domain annotation for each sequence (and alignments):
>> WP_003460364.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.0 0.0 3.1e-28 3.1e-28 1 89 [. 50 138 .. 50 147 .. 0.94
Alignments for each domain:
== domain 1 score: 84.0 bits; conditional E-value: 3.1e-28
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekal 89
gv+++ d+d+++l a l+r +++ +efpk +DGRg+++ar LRer++y+g++rA G +l+Dq+++l +cG +++ ++ + ++++a
WP_003460364.1 50 GVWVTGDQDPADLLALLNRTRVVVIEFPKSRDGRGFTLARVLRERHRYDGDIRAAGPLLPDQFSMLIQCGYTSVLAEAAIPLVRWKEAA 138
8*************************************************************************999988887777765 PP
Or compare WP_003460364.1 to CDD or PaperBLAST