PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003461611.1 to PF04304 (DUF454)

WP_003461611.1 has 132 amino acids

Query:       DUF454  [M=115]
Accession:   PF04304.17
Description: Protein of unknown function (DUF454)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.7e-46  141.5   8.6    6.5e-46  141.3   8.6    1.0  1  WP_003461611.1  


Domain annotation for each sequence (and alignments):
>> WP_003461611.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  141.3   8.6   6.5e-46   6.5e-46       1     115 []      14     128 ..      14     128 .. 0.98

  Alignments for each domain:
  == domain 1  score: 141.3 bits;  conditional E-value: 6.5e-46
          DUF454   1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95 
                     r++ll++G+ls+alGviGi+lP+LPTtpFlLlAa+cf+rss+r++ wL++h+++gp ird+ e+++iplk Kv al+lm++s+++s++lv+++w+
  WP_003461611.1  14 RYMLLAIGWLSVALGVIGIFLPVLPTTPFLLLAAACFVRSSRRFYLWLVTHPRLGPWIRDYLEGQGIPLKGKVYALVLMWVSISFSCYLVPMPWA 108
                     789******************************************************************************************** PP

          DUF454  96 killalvlllvllyllrlpt 115
                     +++++  ++lv+ly+l+ +t
  WP_003461611.1 109 RAFMLSSAVLVSLYILKQKT 128
                     ***************99876 PP



Or compare WP_003461611.1 to CDD or PaperBLAST